Loading...
Statistics
Advertisement

Lisa Cloud
www.lisa.cloud/

Lisa.cloud

Advertisement
Conversion Technology Metas Server
Lisa.cloud is hosted in United States / Tulsa . Lisa.cloud uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: LiteSpeed.

Technologies in use by Lisa.cloud

Technology

Number of occurences: 1
  • Html

Advertisement

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • LiteSpeed

Google Analytics ID

  • UA-74119964-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Lisa.cloud

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.hostwindsdns.com
    • subject:
      • OU: Domain Control Validated
      • CN: *.hostwindsdns.com
    • hash: 574bbd3d
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: AlphaSSL CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492326415647996981434448300124113672065422
    • validFrom: 150415205003Z
    • validTo: 180415205003Z
    • validFrom_time_t: 1429131003
    • validTo_time_t: 1523825403
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:*.hostwindsdns.com, DNS:hostwindsdns.com
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl2.alphassl.com/gs/gsalphasha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure2.alphassl.com/cacert/gsalphasha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsalphasha2g2
      • subjectKeyIdentifier: D2:44:B3:F0:70:63:2C:49:45:AE:60:25:57:5D:94:AF:FD:42:5D:1F
      • authorityKeyIdentifier: keyid:F5:CD:D5:3C:08:50:F9:6A:4F:3A:B7:97:DA:56:83:E6:69:D2:68:F7

Meta - Lisa.cloud

Number of occurences: 0

Server / Hosting

  • IP: 104.168.179.119
  • Latitude: 36.16
  • Longitude: -95.99
  • Country: United States
  • City: Tulsa

Rname

  • seans4.hostwindsdns.com
  • seans3.hostwindsdns.com
  • lisa.cloud

Target

  • serverhealth.hostwinds.com

HTTP Header Response

HTTP/1.1 200 OK ETag: "226-56ca58b9-1a2601d3237e9c46" Last-Modified: Mon, 22 Feb 2016 00:39:21 GMT Content-Type: text/html Content-Length: 550 Date: Wed, 28 Sep 2016 00:43:49 GMT Accept-Ranges: bytes Server: LiteSpeed X-Cache: MISS from s_hv897 Via: 1.1 s_hv897 (squid/3.5.20) Connection: keep-alive

DNS

host: lisa.cloud
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 104.168.179.119
host: lisa.cloud
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: seans4.hostwindsdns.com
host: lisa.cloud
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: seans3.hostwindsdns.com
host: lisa.cloud
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: seans3.hostwindsdns.com
  5. rname: serverhealth.hostwinds.com
  6. serial: 2016022103
  7. refresh: 3600
  8. retry: 7200
  9. expire: 1209600
  10. minimum-ttl: 86400
host: lisa.cloud
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: lisa.cloud

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.isa.cloud, www.luisa.cloud, www.uisa.cloud, www.l8isa.cloud, www.8isa.cloud, www.l9isa.cloud, www.9isa.cloud, www.ljisa.cloud, www.jisa.cloud, www.l0isa.cloud, www.0isa.cloud, www.lmisa.cloud, www.misa.cloud, www.lpisa.cloud, www.pisa.cloud, www.loisa.cloud, www.oisa.cloud, www.lsa.cloud, www.lirsa.cloud, www.lrsa.cloud, www.lifsa.cloud, www.lfsa.cloud, www.livsa.cloud, www.lvsa.cloud, www.liksa.cloud, www.lksa.cloud, www.li,sa.cloud, www.l,sa.cloud, www.libsa.cloud, www.lbsa.cloud, www.ligsa.cloud, www.lgsa.cloud, www.litsa.cloud, www.ltsa.cloud, www.liysa.cloud, www.lysa.cloud, www.liusa.cloud, www.lusa.cloud, www.lijsa.cloud, www.ljsa.cloud, www.limsa.cloud, www.lmsa.cloud, www.linsa.cloud, www.lnsa.cloud, www.lia.cloud, www.lisea.cloud, www.liea.cloud, www.liswa.cloud, www.liwa.cloud, www.lisda.cloud, www.lida.cloud, www.lisxa.cloud, www.lixa.cloud, www.lisfa.cloud, www.lifa.cloud, www.lisga.cloud, www.liga.cloud, www.lista.cloud, www.lita.cloud, www.lis.cloud, www.lisao.cloud, www.liso.cloud, www.lisap.cloud, www.lisp.cloud, www.lisa9.cloud, www.lis9.cloud, www.lisa.cloud, www.lis.cloud, www.lisai.cloud, www.lisi.cloud, www.lisau.cloud, www.lisu.cloud,

Other websites we recently analyzed

  1. Hoedown Time
    Line dancing
    United States - 75.98.17.66
    Server software: Webs.com/1.0
    Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, Google Analytics
    Number of Javascript: 6
    Number of meta tags: 5
  2. avalonspb.ru - Diese Website steht zum Verkauf! - Informationen zum Thema webarchiv.
    Diese Website steht zum Verkauf! avalonspb.ru ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf avalonspb.ru alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Germany - 82.98.86.164
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5
  3. DrinK.TeaM
    Team de poivrons - Have a drink
    France - 91.121.119.173
    Server software: Apache
    Technology: Html, Iframe, Javascript, Php, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 5
  4. media-magnat.com
    Ukraine - 91.200.40.52
    Server software: nginx/1.2.1
    Technology: Html
  5. sriswamisamarthvishwakalyankendra.org
    Santa Ana (United States) - 107.6.45.89
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 8
    Number of meta tags: 2
  6. Home
    Germany - 82.165.217.52
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, Facebook Box, Twitter Button
    Number of Javascript: 2
    Number of meta tags: 2
  7. Welcome to buahkaleng.com
    Welcome to buahkaleng.com
    Miami (United States) - 104.238.136.38
    Server software: nginx
    Technology: Google Adsense, Javascript, Php
    Number of Javascript: 5
    Number of meta tags: 4
  8. Финансовый портал – кредиты, ипотека, кредитные карты
    Финансовый портал – кредиты, ипотека, кредитные карты
    Russian Federation - 80.78.250.26
    Server software: nginx
    Technology: CSS, Google Font API, Html, Javascript, jQuery, MooTools, Php, Yandex.Metrika, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 4
  9. huyan.com
    New York (United States) - 69.172.201.208
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  10. Home - Aeka Biochemicals Pvt. Ltd.
    Orlando (United States) - 184.171.254.44
    G Analytics ID: UA-53264454-1
    Server software: Apache
    Technology: CSS, Flexslider, Google Font API, Html, Html5, Javascript, Lightbox, Php, Pingback, Google Analytics, Wordpress, Facebook Box
    Number of Javascript: 15
    Number of meta tags: 5

Check Other Websites